PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr1g024025.1
Common NameMTR_1g024025
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family ARF
Protein Properties Length: 1266aa    MW: 141164 Da    PI: 5.111
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr1g024025.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B375.56.2e-24146247199
                      EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSS CS
               B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrs 88 
                      f+k+lt sd++++g +++p++ ae+        +++++ ++l+++d++ ++W++++iyr++++r++lt+GW+ Fv +++L++gD+v+F   +++
  Medtr1g024025.1 146 FCKTLTASDTSTHGGFSVPRRAAEKLfppldyTIQPPT-QELVVRDLHDNTWTFRHIYRGQPKRHLLTTGWSLFVGSKRLRAGDSVLFI--RDE 236
                      99*********************999*****9555555.49************************************************..457 PP

                      EE..EEEEE-S CS
               B3  89 efelvvkvfrk 99 
                      + +l+v+v+r+
  Medtr1g024025.1 237 KSQLRVGVRRA 247
                      7778****997 PP

2Auxin_resp112.83.2e-37272355183
       Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalk.vkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                      aahaa+++s+F+++YnPra++s+Fv++++k++k+++ +++s+GmRf m+fete+s +rr++Gt+vg+sd+dp+rWp+SkWr+++
  Medtr1g024025.1 272 AAHAAANRSPFTIFYNPRACPSDFVIPLAKYRKSVYgTQLSAGMRFGMMFETEESGKRRYMGTIVGISDVDPLRWPGSKWRNIQ 355
                      79**********************************9********************************************986 PP

3Auxin_resp36.32.5e-13898940145
       Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRf 45 
                      aahaa+++ +F+++YnPra+ s+Fv++++k +  +  ++svGmRf
  Medtr1g024025.1 898 AAHAAANRIPFTIFYNPRACLSDFVIPLAKSVYGT--QLSVGMRF 940
                      79**************************9877665..9******9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019362.62E-46136275IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.4E-41138260IPR015300DNA-binding pseudobarrel domain
CDDcd100179.66E-23145246No hitNo description
SMARTSM010196.3E-25146248IPR003340B3 DNA binding domain
PROSITE profilePS5086313.056146248IPR003340B3 DNA binding domain
PfamPF023622.1E-21146247IPR003340B3 DNA binding domain
PfamPF065075.0E-32272355IPR010525Auxin response factor
PfamPF023095.4E-11743841IPR033389AUX/IAA domain
PROSITE profilePS5174523.746754838IPR000270PB1 domain
SuperFamilySSF542776.57E-8755833No hitNo description
PfamPF065071.1E-7898940IPR010525Auxin response factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0009908Biological Processflower development
GO:0009942Biological Processlongitudinal axis specification
GO:0010305Biological Processleaf vascular tissue pattern formation
GO:0048364Biological Processroot development
GO:0048507Biological Processmeristem development
GO:0005634Cellular Componentnucleus
GO:0016020Cellular Componentmembrane
GO:0042802Molecular Functionidentical protein binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1266 aa     Download sequence    Send to blast
MASLDEKAKS VGGVVGGQTL VAEMKLLKEM QEHCGVRKTL NSELWHACAG PLVSLPQVGG  60
LVYYFPQGHS EQVAASTRRI ATSQIPNYPS LPSQLLCQVQ NVTLHADKET DEIYAQMTLQ  120
PLNSEKEVFP VSEFGLSKSK HPTEFFCKTL TASDTSTHGG FSVPRRAAEK LFPPLDYTIQ  180
PPTQELVVRD LHDNTWTFRH IYRGQPKRHL LTTGWSLFVG SKRLRAGDSV LFIRDEKSQL  240
RVGVRRANRQ QTTLPSSVLS ADSMHIGVLA AAAHAAANRS PFTIFYNPRA CPSDFVIPLA  300
KYRKSVYGTQ LSAGMRFGMM FETEESGKRR YMGTIVGISD VDPLRWPGSK WRNIQAEWDE  360
PGCGDKQNRV SVWEIETPES LFIFPSLTSS LKRPLQSGYL ENEWGTLIRR PFIKVPENGG  420
TVEISSSMQN LYQENMKMFY KPQVINNSGA FLPIMQQDYS PTRVPFQDMK STQALENPKV  480
HLSSTESIPN NTFNMHSLLK NDQPEKLQPL AKTDNSKLES EVLPDHIFDF PSFESCSNIE  540
KVNTANQLTY HNQNQSQNPL LAHTSPWTMQ QPQLESSMSH PQLIDMVQPD SSIVNSMLPQ  600
LDVDEWMMYS SCQPQVVNPS IPSMNQEVWD QYVKNFNLRD LSAESNNQSE ICVNVDASNS  660
VSTTVVDPST SNTIFDDFCS MKDKDFQHPQ DCMVGNLSSS QDGQSQITSA SLAESHAFSL  720
RDNSGGTSSS HVDFDESSFL QNNNSWKQVA APIRTYTKVQ KAGSVGRSID VTTFKNYEEL  780
IRAIECMFGL DGLLNDTKGS GWKLVYVDYE SDVLLVGDDP WEEFVGCVRC IRILSPSEVK  840
EMSEEGMKLL NSGALQGINV DEKSPLRVGV RRANRQQTTL PSSVLSADSM HIGVLAAAAH  900
AAANRIPFTI FYNPRACLSD FVIPLAKSVY GTQLSVGMRF GCLRPRNRAE WDEPGCGDKQ  960
NRLQPLAKTD NSKLESEVLP DHMFDFPSFE SCSNIEKLES SMSHPQLIDM VQPDSSIANS  1020
MLPQLDVDEW MMYSSCQPQV VNPSIPSMNQ EMWDQYVKNF NLRDLSAESN NQSEICVNVD  1080
ATNSVSTTMV DPSTTNTIFD EFCSMKDKDF QHPQDCAVGN LSSSQDGQSQ ITSASLAESH  1140
AFSLRDNSGG TSSSHVDFDE SIFLQNNNSW KQVAAPIRTY TKLEKAGSVG RSIDVTTFKN  1200
YEELIRAIEY MFGLDGLLND TKDDPWKEFV GCVRRIRILS PSEVKEMSEE GMKLLNSGAL  1260
QGINV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A0.01996532392Auxin response factor 5
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.250920.0root
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). {ECO:0000256|RuleBase:RU004561}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00153DAPTransfer from AT1G19850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013466172.10.0auxin response factor 2
SwissprotP930240.0ARFE_ARATH; Auxin response factor 5
TrEMBLA0A072VFI00.0A0A072VFI0_MEDTR; Auxin response factor
STRINGGLYMA14G40540.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF89913241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19850.10.0ARF family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]